shanitrox: I wont good Girl for Marry
My Details
- I am: 30 yr-old man seeking woman, 18-99
- Located in: Matale, Central, Sri Lanka, South Asia
- Last online: Online over 1 month
- Height: 5' 8" (173 cm)
- Body Type: Slim/Slender
- Hair Color: Black
- Eye Color: Brown
- Ethnicity: White/Caucasian
- Education: Bachelors Degree
- Religion: Christian/Catholic
- Occupation: Fitness / Sports
- Income: ---
- Smokes: Never
- Drinks: Occasionally
- Marital Status: Never Married
- Has kids: No
- Wants kids: Someday
- Sign:
Sagittarius
More About Me
The canonical UR multiple og:type values are not possible. Find the full list of object types in our Object Types Reference
og:locale
The locale of the resource. Defaults to en_US. You can also use og:locale:alternate if you have other available language translations available. Learn about the locales we support in our documentation on localization.
You can add additional markup if your content includes audio, video, or location information. See all standard object properties
More About my Match
Aamsmsnndnxmcnmcmclldkskkskdkfdkwlqlqlqqksdmdqkkkss qkkmdnfndnd wkwwksmrnn jwkwmsm dnndw wkwkndbsnwkqkkwdmdjwkkqlwmnnndewwi owkwwkaksmdd wkwkwkwkw q
The canonical URL for your page. This should be the undecorated URL, without session variables, user identifying parameters, or counters. Likes and Shares for this URL will aggregate at this URL. For example, mobile domain URLs should point to the desktop version of the URL as the canonical URL to aggregate Likes and Shares across different versions of the page.
og:title
The title of your article without any branding such as your site name.
og:description
A brief description of the content, usually between 2 and 4 sentences. This will displayed below the title of the post on Facebook.
og:i for
Occupation
Sssssssssssssssssssssssssee
To Report Abuse: If this profile or the behavior of the member is inappropriate, click here to Report Abuse »